PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 1026aa    MW: 112701 Da    PI: 4.7324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0383genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-183985148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
      Gh_A05G0383 39 KGQWTAEEDEILRKAVQHFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 85
                     799****************************9.************986 PP

2Myb_DNA-binding651.4e-2091137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEdel++++v+++G++ W+tIa++++ gR +kqc++rw+++l
      Gh_A05G0383  91 KGPWSKEEDELIIELVNKFGPKKWSTIAQHLP-GRIGKQCRERWHNHL 137
                      79******************************.*************97 PP

3Myb_DNA-binding51.13e-16143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+  ++ ++ gRt++ +k++w+
      Gh_A05G0383 143 KQAWTQEEELALIRAHQIFGNR-WAELSKFLP-GRTDNAIKNHWN 185
                      799*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4263485IPR017930Myb domain
SuperFamilySSF466897.9E-163592IPR009057Homeodomain-like
SMARTSM007172.7E-153887IPR001005SANT/Myb domain
PfamPF002491.7E-153985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2441102IPR009057Homeodomain-like
CDDcd001676.05E-144285No hitNo description
PROSITE profilePS5129433.41686141IPR017930Myb domain
SuperFamilySSF466899.36E-3288184IPR009057Homeodomain-like
SMARTSM007171.5E-1990139IPR001005SANT/Myb domain
PfamPF002493.4E-1991137IPR001005SANT/Myb domain
CDDcd001674.13E-1793137No hitNo description
Gene3DG3DSA:1.10.10.607.0E-28103144IPR009057Homeodomain-like
PROSITE profilePS5129420.4142192IPR017930Myb domain
SMARTSM007174.8E-16142190IPR001005SANT/Myb domain
PfamPF002491.7E-14143186IPR001005SANT/Myb domain
CDDcd001671.83E-12145185No hitNo description
Gene3DG3DSA:1.10.10.602.8E-22145192IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1026 aa     Download sequence    Send to blast
MESDRTVSTP SVGLSISDDA QRMRALHGRT TGPTRRSTKG QWTAEEDEIL RKAVQHFKGK  60
NWKKIAECFK DRTDVQCLHR WQKVLNPELV KGPWSKEEDE LIIELVNKFG PKKWSTIAQH  120
LPGRIGKQCR ERWHNHLNPS INKQAWTQEE ELALIRAHQI FGNRWAELSK FLPGRTDNAI  180
KNHWNSSIKK KLDSYIASGL LEQFQFSLLA NQSQPTPSSY STIPSNVDDS ASKCRTETED  240
ISECSQESAM VSCSQSTSDL AKAAVHTREQ FYMTEKLGVA KEKNSSPAPC SEEYYPSLED  300
VNFSMPEISS EGNSTGGNYQ FGLQDLPNIS SLDLGKESSG LPNNCLETSE GCEVMNIAFQ  360
SSVGLNAPVS FINMVTTSDK PEQTLIPDDE CCSVLFSENF TQGSNMVELG GFTNASLSQA  420
SGMQITETGR IPASQSNCLS RSEVLPSSQA FVSPSRLAVE DGTLTFGGES CPLNGQPFGT  480
QDQEFTMNTH DGFIYTIDDH TDSTDLQEQS YLDKDSRKLV PVNTFGLESN VAQSCPAEDD  540
KPTLPAEQDF CGLCYEPPRF LSLDIPFFNC DLIPSGSDMQ QEYSPLGIRQ LMMSTNCISP  600
FRLWDSPSRD NSPDVVLKSA AKTFTGTPSI LKKRHRDLLS PLSERQSEKK LGTDMASNLT  660
KGFSRLDVMF DESGTGNTTQ LSPSEHITNS SVSIKEKENI SQALDEEYDN GGVHAQPLED  720
ETPKGSDGTN SLGNIEKGVC EIDTKDKTDI DASYRTVQRP PAVLVEHDIN DILLFSPDDV  780
GLKAGLPLRF SSMRTPKNQY HKSLGAISNQ GLASECLSGN ACIIVSSPTL KIKKSEDPSI  840
ADTTVQFSSS SATLENSVDN TGSNAAIENY NIFGGTPFKR SIESPSAWKS PWFINSFVPG  900
PRIDTDITIE DIGYLMTPAE RSYDAIGLMK QLSEHGAAAY ADALEVLGNE TPQSIIKGRG  960
SNNSNNIDKE NNQLENHSHL ASNIMVERRI LDFSECGTPG KGAENGKSST AMSYSSPSSY  1020
LLKGLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-72391926159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-72391926159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.196010.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446764.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_012446765.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0B0NXX80.0A0A0B0NXX8_G
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein